DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr1H and Tcea1

DIOPT Version :10

Sequence 1:NP_524439.1 Gene:Polr1H / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001020906.1 Gene:Tcea1 / 362479 RGDID:1309880 Length:301 Species:Rattus norvegicus


Alignment Length:95 Identity:28/95 - (29%)
Similarity:40/95 - (42%) Gaps:11/95 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VKGNVICYNCKKEFQPDVYSGEKSEFTIHFNTYDPSKVFNRTK---RESESDADGPVVER--KCP 82
            ::.||:|.|    ..||:::...:|........:..|  |.||   ||.:....|.....  .|.
  Rat   206 LRKNVLCGN----IPPDLFARMTAEEMASDELKEMRK--NLTKEAIREHQMAKTGGTQTDLFTCG 264

  Fly    83 KCNHDKMSYATLQLRSADEGQTVFFTCLKC 112
            ||.....:|..:|.|||||..|.|..|.:|
  Rat   265 KCKKKNCTYTQVQTRSADEPMTTFVVCNEC 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr1HNP_524439.1 RPB9 10..115 CDD:441202 28/95 (29%)
Zn-ribbon_RPA12 73..119 CDD:259792 15/42 (36%)
Tcea1NP_001020906.1 TFSII 4..301 CDD:273592 28/95 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..139
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.