DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpI12 and Polr1h

DIOPT Version :9

Sequence 1:NP_524439.1 Gene:RpI12 / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001159772.1 Gene:Polr1h / 361784 RGDID:1303114 Length:123 Species:Rattus norvegicus


Alignment Length:116 Identity:52/116 - (44%)
Similarity:72/116 - (62%) Gaps:13/116 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FCPSCGSILPELQVKGNVICYNCKKEFQPDV--YSGEKSEFTIHFN---TYDPSKVFNRTKRESE 69
            |||.|||:||...|:..|||..|  .|..||  :.|:..:.::.||   |..|..|      :..
  Rat    16 FCPDCGSVLPLPGVQDTVICPRC--GFSIDVRDFGGKVVKTSVVFNKLGTVIPMSV------DEG 72

  Fly    70 SDADGPVVERKCPKCNHDKMSYATLQLRSADEGQTVFFTCLKCKFKESENS 120
            .::.||||:|:|.:|.|:.|:|.|.|:||||||||||:||:.|||:|.|:|
  Rat    73 PESQGPVVDRRCSRCGHEGMAYYTRQMRSADEGQTVFYTCINCKFQEKEDS 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpI12NP_524439.1 RPB9 10..119 CDD:224510 50/113 (44%)
Zn-ribbon_RPA12 73..119 CDD:259792 28/45 (62%)
Polr1hNP_001159772.1 RPB9 16..122 CDD:224510 50/113 (44%)
OrfB_Zn_ribbon <17..46 CDD:284650 15/30 (50%)
Zn-ribbon_RPA12 76..122 CDD:259792 28/45 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353999
Domainoid 1 1.000 59 1.000 Domainoid score I10485
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40960
Inparanoid 1 1.050 98 1.000 Inparanoid score I4920
OMA 1 1.010 - - QHG57307
OrthoDB 1 1.010 - - D1456544at2759
OrthoFinder 1 1.000 - - FOG0003996
OrthoInspector 1 1.000 - - oto97923
orthoMCL 1 0.900 - - OOG6_103317
Panther 1 1.100 - - LDO PTHR11239
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2760
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.