DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr1H and Polr1h

DIOPT Version :10

Sequence 1:NP_524439.1 Gene:Polr1H / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_998732.1 Gene:Polr1h / 361784 RGDID:1303114 Length:123 Species:Rattus norvegicus


Alignment Length:116 Identity:52/116 - (44%)
Similarity:72/116 - (62%) Gaps:13/116 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FCPSCGSILPELQVKGNVICYNCKKEFQPDV--YSGEKSEFTIHFN---TYDPSKVFNRTKRESE 69
            |||.|||:||...|:..|||..|  .|..||  :.|:..:.::.||   |..|..|      :..
  Rat    16 FCPDCGSVLPLPGVQDTVICPRC--GFSIDVRDFGGKVVKTSVVFNKLGTVIPMSV------DEG 72

  Fly    70 SDADGPVVERKCPKCNHDKMSYATLQLRSADEGQTVFFTCLKCKFKESENS 120
            .::.||||:|:|.:|.|:.|:|.|.|:||||||||||:||:.|||:|.|:|
  Rat    73 PESQGPVVDRRCSRCGHEGMAYYTRQMRSADEGQTVFYTCINCKFQEKEDS 123

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Polr1HNP_524439.1 RPB9 10..115 CDD:441202 48/109 (44%)
Zn-ribbon_RPA12 73..119 CDD:259792 28/45 (62%)
Polr1hNP_998732.1 RPB9 16..115 CDD:441202 46/106 (43%)
Zn-ribbon_RPA12 76..122 CDD:259792 28/45 (62%)