powered by:
Protein Alignment RpI12 and CG8117
DIOPT Version :9
Sequence 1: | NP_524439.1 |
Gene: | RpI12 / 42563 |
FlyBaseID: | FBgn0038903 |
Length: | 120 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_573049.2 |
Gene: | CG8117 / 32499 |
FlyBaseID: | FBgn0030663 |
Length: | 162 |
Species: | Drosophila melanogaster |
Alignment Length: | 33 |
Identity: | 12/33 - (36%) |
Similarity: | 17/33 - (51%) |
Gaps: | 2/33 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 80 KCPKCNHDKMSYATLQLRSADEGQTVFFTCLKC 112
||.:| ||.:.:.|.:|..||....|..|.:|
Fly 126 KCERC--DKRNCSQLHIRDGDEPIITFVICDEC 156
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1594 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.