DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpI12 and POLR1H

DIOPT Version :9

Sequence 1:NP_524439.1 Gene:RpI12 / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001265714.1 Gene:POLR1H / 30834 HGNCID:13182 Length:126 Species:Homo sapiens


Alignment Length:129 Identity:51/129 - (39%)
Similarity:68/129 - (52%) Gaps:15/129 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDIFSNCPG------FCPSCGSILPELQVKGNVICYNCKKEFQPDVYSGE--KSEFTIH-FNTYD 56
            ||:.:.|..      ||..|||:||....:..|.|..|........:.|:  |:....| ..|..
Human     4 MDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAM 68

  Fly    57 PSKVFNRTKRESESDADGPVVERKCPKCNHDKMSYATLQLRSADEGQTVFFTCLKCKFKESENS 120
            |..|      |...:..||||:|:||:|.|:.|:|.|.|:||||||||||:||..|||:|.|:|
Human    69 PMSV------EEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpI12NP_524439.1 RPB9 10..119 CDD:224510 46/111 (41%)
Zn-ribbon_RPA12 73..119 CDD:259792 29/45 (64%)
POLR1HNP_001265714.1 DnaJ <20..>102 CDD:333066 28/87 (32%)
Zn-ribbon_RPA12 79..125 CDD:259792 29/45 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159935
Domainoid 1 1.000 61 1.000 Domainoid score I10507
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40960
Inparanoid 1 1.050 95 1.000 Inparanoid score I5063
Isobase 1 0.950 - 0 Normalized mean entropy S1392
OMA 1 1.010 - - QHG57307
OrthoDB 1 1.010 - - D1456544at2759
OrthoFinder 1 1.000 - - FOG0003996
OrthoInspector 1 1.000 - - oto90825
orthoMCL 1 0.900 - - OOG6_103317
Panther 1 1.100 - - LDO PTHR11239
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1171
SonicParanoid 1 1.000 - - X2760
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.