DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr1H and Tcea3

DIOPT Version :10

Sequence 1:NP_524439.1 Gene:Polr1H / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001015008.1 Gene:Tcea3 / 298559 RGDID:1311369 Length:348 Species:Rattus norvegicus


Alignment Length:131 Identity:29/131 - (22%)
Similarity:38/131 - (29%) Gaps:49/131 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NCKK---EFQPDVYSGEKSEFTIHFN------------------------TYDPSKVFNRTKRES 68
            ||.|   |.:..:|...||....:.|                        |..|..:...|..|.
  Rat   211 NCDKLASEIEDHIYQELKSTDMKYRNRVRSRISNLKDPRNPGLRRNVLSGTISPELIAKMTAEEM 275

  Fly    69 ESD---------------------ADGPVVE-RKCPKCNHDKMSYATLQLRSADEGQTVFFTCLK 111
            .||                     ..|...: .:|.||.....:|..:|.|||||..|.|..|.:
  Rat   276 ASDELRELRNAMTQEAIREHQMAKTGGTTTDLLRCSKCKKKNCTYNQVQTRSADEPMTTFVLCNE 340

  Fly   112 C 112
            |
  Rat   341 C 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr1HNP_524439.1 RPB9 10..115 CDD:441202 29/131 (22%)
Zn-ribbon_RPA12 73..119 CDD:259792 15/41 (37%)
Tcea3NP_001015008.1 TFSII 5..348 CDD:273592 29/131 (22%)

Return to query results.
Submit another query.