DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment RpI12 and Tcea3

DIOPT Version :9

Sequence 1:	NP_524439.1	Gene:	RpI12 / 42563	FlyBaseID:	FBgn0038903	Length:	120	Species:	Drosophila melanogaster
Sequence 2:	NP_001015008.1	Gene:	Tcea3 / 298559	RGDID:	1311369	Length:	348	Species:	Rattus norvegicus

Alignment Length:	131	Identity:	29/131 - (22%)
Similarity:	38/131 - (29%)	Gaps:	49/131 - (37%)

- Green bases have known domain annotations that are detailed below.

  Fly    31 NCKK---EFQPDVYSGEKSEFTIHFN------------------------TYDPSKVFNRTKRES 68
            ||.|   |.:..:|...||....:.|                        |..|..:...|..|.
  Rat   211 NCDKLASEIEDHIYQELKSTDMKYRNRVRSRISNLKDPRNPGLRRNVLSGTISPELIAKMTAEEM 275

  Fly    69 ESD---------------------ADGPVVE-RKCPKCNHDKMSYATLQLRSADEGQTVFFTCLK 111
            .||                     ..|...: .:|.||.....:|..:|.|||||..|.|..|.:
  Rat   276 ASDELRELRNAMTQEAIREHQMAKTGGTTTDLLRCSKCKKKNCTYNQVQTRSADEPMTTFVLCNE 340

  Fly   112 C 112
            |
  Rat   341 C 341

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
RpI12	NP_524439.1	RPB9	10..119	CDD:224510	29/131 (22%)
RpI12	NP_524439.1	Zn-ribbon_RPA12	73..119	CDD:259792	15/41 (37%)
Tcea3	NP_001015008.1	TFIIS_I	4..80	CDD:238107
		TFSII	5..348	CDD:273592	29/131 (22%)
		TFIIS_M	185..292	CDD:284835	14/80 (18%)
		Zn-ribbon_TFIIS	301..347	CDD:259796	15/41 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1594
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810