DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpI12 and Polr2i

DIOPT Version :9

Sequence 1:NP_524439.1 Gene:RpI12 / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001099714.1 Gene:Polr2i / 292778 RGDID:1309395 Length:125 Species:Rattus norvegicus


Alignment Length:118 Identity:27/118 - (22%)
Similarity:43/118 - (36%) Gaps:28/118 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PG-----FCPSCGSILPELQVKGNVI----CYNCKKEFQPDVYSGEKSEFTIHFNTYDPSKVFNR 63
            ||     ||..|.::|...:.|.|.|    |.||.       |..|.....|:.|     |:.:.
  Rat     9 PGFVGIRFCQECNNMLYPKEDKENRILLYACRNCD-------YQQEADNSCIYVN-----KITHE 61

  Fly    64 TKRESESDAD---GPVVER----KCPKCNHDKMSYATLQLRSADEGQTVFFTC 109
            ....::..||   .|.:.|    .|.||.|.:..:.......|::...:::.|
  Rat    62 VDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVC 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpI12NP_524439.1 RPB9 10..119 CDD:224510 25/111 (23%)
Zn-ribbon_RPA12 73..119 CDD:259792 9/44 (20%)
Polr2iNP_001099714.1 RPB9 14..125 CDD:224510 25/113 (22%)
Zn-ribbon_RPB9 74..124 CDD:259793 8/41 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.