DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpI12 and rpa12

DIOPT Version :9

Sequence 1:NP_524439.1 Gene:RpI12 / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_588059.1 Gene:rpa12 / 2538906 PomBaseID:SPCC1259.03 Length:119 Species:Schizosaccharomyces pombe


Alignment Length:112 Identity:36/112 - (32%)
Similarity:58/112 - (51%) Gaps:2/112 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FCPSCGSILPELQVKGNVICYNCKKEFQPDVYSGEKSEFTIHFNTYDPSKVFNRTKRESESD-AD 73
            ||..||::|.....:... |..|:..:..:.::....|.....:.:..:.....:..:.||. .:
pombe     9 FCSECGNLLESTTAQWTT-CDQCQSVYPSEQFANLVVETKSSASAFPSALKLKHSIVQVESQKEE 72

  Fly    74 GPVVERKCPKCNHDKMSYATLQLRSADEGQTVFFTCLKCKFKESENS 120
            ...:|.|||||.:|.|::.||||||||||.|||:.|.:|.:|.|.|:
pombe    73 AATIEEKCPKCGNDHMTFHTLQLRSADEGSTVFYECPRCAYKFSTNN 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpI12NP_524439.1 RPB9 10..119 CDD:224510 35/109 (32%)
Zn-ribbon_RPA12 73..119 CDD:259792 25/45 (56%)
rpa12NP_588059.1 RPB9 6..118 CDD:224510 35/109 (32%)
RPOL9 8..56 CDD:197822 8/47 (17%)
Zn-ribbon_RPA12 72..118 CDD:259792 25/45 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I3130
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I1923
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003996
OrthoInspector 1 1.000 - - oto101697
orthoMCL 1 0.900 - - OOG6_103317
Panther 1 1.100 - - LDO PTHR11239
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1171
SonicParanoid 1 1.000 - - X2760
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.