DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr1H and Tceanc

DIOPT Version :10

Sequence 1:NP_524439.1 Gene:Polr1H / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001007578.2 Gene:Tceanc / 245695 MGIID:2685236 Length:359 Species:Mus musculus


Alignment Length:60 Identity:15/60 - (25%)
Similarity:23/60 - (38%) Gaps:12/60 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 EKSEFTIHFNTYDPSKVFNRTKRESESDADGPVVERKCPKCNHDKMSY--ATLQLRSADE 101
            |:..||:|.|.....|...|:|          |...|.|:..|.:.::  .|:..|...|
Mouse   215 EEHIFTLHSNNIKKYKTSIRSK----------VANLKNPRNFHLQQNFLSGTMSAREFAE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr1HNP_524439.1 RPB9 10..115 CDD:441202 15/60 (25%)
Zn-ribbon_RPA12 73..119 CDD:259792 7/31 (23%)
TceancNP_001007578.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..118
TFIIS_M 181..290 CDD:462184 15/60 (25%)
Zn-ribbon 298..351 CDD:445850
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.