DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr1H and Tcea3

DIOPT Version :10

Sequence 1:NP_524439.1 Gene:Polr1H / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:XP_006538773.1 Gene:Tcea3 / 21401 MGIID:1196908 Length:385 Species:Mus musculus


Alignment Length:33 Identity:14/33 - (42%)
Similarity:18/33 - (54%) Gaps:0/33 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 KCPKCNHDKMSYATLQLRSADEGQTVFFTCLKC 112
            :|.||.....:|..:|.|||||..|.|..|.:|
Mouse   346 RCSKCKKKNCTYNQVQTRSADEPMTTFVLCNEC 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr1HNP_524439.1 RPB9 10..115 CDD:441202 14/33 (42%)
Zn-ribbon_RPA12 73..119 CDD:259792 14/33 (42%)
Tcea3XP_006538773.1 TFSII 5..385 CDD:273592 14/33 (42%)

Return to query results.
Submit another query.