powered by:
Protein Alignment RpI12 and Tcea2
DIOPT Version :9
Sequence 1: | NP_524439.1 |
Gene: | RpI12 / 42563 |
FlyBaseID: | FBgn0038903 |
Length: | 120 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_033352.1 |
Gene: | Tcea2 / 21400 |
MGIID: | 107368 |
Length: | 299 |
Species: | Mus musculus |
Alignment Length: | 32 |
Identity: | 12/32 - (37%) |
Similarity: | 17/32 - (53%) |
Gaps: | 0/32 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 81 CPKCNHDKMSYATLQLRSADEGQTVFFTCLKC 112
|.||.....:|..:|.||:||..|.:..|.:|
Mouse 261 CNKCRKKNCTYTQVQTRSSDEPMTTYVVCNEC 292
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1594 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.