DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpI12 and Tcea1

DIOPT Version :9

Sequence 1:NP_524439.1 Gene:RpI12 / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001153223.1 Gene:Tcea1 / 21399 MGIID:1196624 Length:312 Species:Mus musculus


Alignment Length:95 Identity:28/95 - (29%)
Similarity:40/95 - (42%) Gaps:11/95 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VKGNVICYNCKKEFQPDVYSGEKSEFTIHFNTYDPSKVFNRTK---RESESDADGPVVER--KCP 82
            ::.||:|.|    ..||:::...:|........:..|  |.||   ||.:....|.....  .|.
Mouse   217 LRKNVLCGN----IPPDLFARMTAEEMASDELKEMRK--NLTKEAIREHQMAKTGGTQTDLFTCG 275

  Fly    83 KCNHDKMSYATLQLRSADEGQTVFFTCLKC 112
            ||.....:|..:|.|||||..|.|..|.:|
Mouse   276 KCKKKNCTYTQVQTRSADEPMTTFVVCNEC 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpI12NP_524439.1 RPB9 10..119 CDD:224510 28/95 (29%)
Zn-ribbon_RPA12 73..119 CDD:259792 15/42 (36%)
Tcea1NP_001153223.1 TFSII 33..312 CDD:273592 28/95 (29%)
TFIIS_I <35..89 CDD:238107
TFIIS_M 149..256 CDD:284835 11/44 (25%)
Zn-ribbon_TFIIS 265..311 CDD:259796 15/41 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.