DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpI12 and rpoa-12

DIOPT Version :9

Sequence 1:NP_524439.1 Gene:RpI12 / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_506572.1 Gene:rpoa-12 / 182648 WormBaseID:WBGene00007616 Length:119 Species:Caenorhabditis elegans


Alignment Length:123 Identity:52/123 - (42%)
Similarity:63/123 - (51%) Gaps:27/123 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FCPSCGSILPEL--QVKGNVICYNCK-----KEFQPDVYSGEKSEFTIHFNTYDPSKVFNRTKR- 66
            ||..||:|| ||  |....|.|..|.     ||....|.|..:             |::.||.. 
 Worm    12 FCGYCGAIL-ELPAQAPATVSCKVCSTRWAVKERVDQVVSRVE-------------KIYERTVAD 62

  Fly    67 ----ESESDADGPVVERKCPKCNHDKMSYATLQLRSADEGQTVFFTCLKCKFKESENS 120
                |::..||. ||:..|.||.|.|.||:|:|.||||||||||:||||||.|:.|.|
 Worm    63 TDGIENDESADA-VVDHICTKCGHSKASYSTMQTRSADEGQTVFYTCLKCKKKDIEYS 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpI12NP_524439.1 RPB9 10..119 CDD:224510 50/120 (42%)
Zn-ribbon_RPA12 73..119 CDD:259792 29/45 (64%)
rpoa-12NP_506572.1 RPB9 12..118 CDD:224510 50/120 (42%)
Zn-ribbon_RPA12 74..117 CDD:259792 28/43 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167443
Domainoid 1 1.000 62 1.000 Domainoid score I6874
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I3885
Isobase 1 0.950 - 0 Normalized mean entropy S1392
OMA 1 1.010 - - QHG57307
OrthoDB 1 1.010 - - D1456544at2759
OrthoFinder 1 1.000 - - FOG0003996
OrthoInspector 1 1.000 - - oto20803
orthoMCL 1 0.900 - - OOG6_103317
Panther 1 1.100 - - LDO PTHR11239
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1171
SonicParanoid 1 1.000 - - X2760
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.790

Return to query results.
Submit another query.