DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr1H and TCEANC2

DIOPT Version :10

Sequence 1:NP_524439.1 Gene:Polr1H / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_694580.1 Gene:TCEANC2 / 127428 HGNCID:26494 Length:208 Species:Homo sapiens


Alignment Length:99 Identity:22/99 - (22%)
Similarity:40/99 - (40%) Gaps:22/99 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LPELQVKGNVICYNCKKEFQPDVYSGEKSEFTIHFNTYDPSK-------------VFNRTKRESE 69
            ||: |.|.|::  ...:|.:..:.|.|..:.|...:|.:..:             |:...|..:|
Human    51 LPD-QTKENLV--EALQELKKKIPSREVLKSTRIGHTVNKMRKHSDSEVASLAREVYTEWKTFTE 112

  Fly    70 SDADGPVVE-RKCPKC-----NHDKMSYATLQLR 97
            ..::.|.:| |..||.     |..|:....|:|:
Human   113 KHSNRPSIEVRSDPKTESLRKNAQKLLSEALELK 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr1HNP_524439.1 RPB9 10..115 CDD:441202 22/99 (22%)
Zn-ribbon_RPA12 73..119 CDD:259792 9/31 (29%)
TCEANC2NP_694580.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
TFIIS_I 40..110 CDD:238107 12/61 (20%)
TFIIS_M 127..>203 CDD:462184 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.