DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpI12 and TCEANC2

DIOPT Version :9

Sequence 1:NP_524439.1 Gene:RpI12 / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_694580.1 Gene:TCEANC2 / 127428 HGNCID:26494 Length:208 Species:Homo sapiens


Alignment Length:99 Identity:22/99 - (22%)
Similarity:40/99 - (40%) Gaps:22/99 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LPELQVKGNVICYNCKKEFQPDVYSGEKSEFTIHFNTYDPSK-------------VFNRTKRESE 69
            ||: |.|.|::  ...:|.:..:.|.|..:.|...:|.:..:             |:...|..:|
Human    51 LPD-QTKENLV--EALQELKKKIPSREVLKSTRIGHTVNKMRKHSDSEVASLAREVYTEWKTFTE 112

  Fly    70 SDADGPVVE-RKCPKC-----NHDKMSYATLQLR 97
            ..::.|.:| |..||.     |..|:....|:|:
Human   113 KHSNRPSIEVRSDPKTESLRKNAQKLLSEALELK 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpI12NP_524439.1 RPB9 10..119 CDD:224510 22/99 (22%)
Zn-ribbon_RPA12 73..119 CDD:259792 9/31 (29%)
TCEANC2NP_694580.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
TFIIS_I 40..110 CDD:238107 12/61 (20%)
TFIIS_M 129..>203 CDD:311443 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.