DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpI12 and polr1h

DIOPT Version :9

Sequence 1:NP_524439.1 Gene:RpI12 / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:XP_002931883.2 Gene:polr1h / 100379834 XenbaseID:XB-GENE-5797380 Length:122 Species:Xenopus tropicalis


Alignment Length:124 Identity:49/124 - (39%)
Similarity:74/124 - (59%) Gaps:6/124 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDI----FSNCPGFCPSCGSILPELQVKGNVICYNCKKEFQPDVYSGEKSEFTIHFNTYDPSKVF 61
            |||    ||:...||..|||:||...::..|.|..|........:.|:..:.::.||..|..|:.
 Frog     1 MDISTTCFSSVSDFCSDCGSVLPPPGIQDTVTCLRCSHRTHVTEFLGKCVQTSVVFNKLDTIKLS 65

  Fly    62 NRTKRESESDADGPVVERKCPKCNHDKMSYATLQLRSADEGQTVFFTCLKCKFKESENS 120
            |.|  |...:..||:::|:|.:|..::|:|.|.|:||||||||||:||:.|:|:|.|:|
 Frog    66 NET--EEAGELKGPLIDRRCSRCGFERMAYHTRQMRSADEGQTVFYTCVNCRFQEKEDS 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpI12NP_524439.1 RPB9 10..119 CDD:224510 42/108 (39%)
Zn-ribbon_RPA12 73..119 CDD:259792 24/45 (53%)
polr1hXP_002931883.2 RPB9 14..121 CDD:224510 42/108 (39%)
Zn-ribbon_RPA12 75..121 CDD:259792 24/45 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I10981
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40960
Inparanoid 1 1.050 104 1.000 Inparanoid score I4823
OMA 1 1.010 - - QHG57307
OrthoDB 1 1.010 - - D1456544at2759
OrthoFinder 1 1.000 - - FOG0003996
OrthoInspector 1 1.000 - - oto104616
Panther 1 1.100 - - LDO PTHR11239
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2760
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.