DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6800 and KIN28

DIOPT Version :9

Sequence 1:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_010175.1 Gene:KIN28 / 851450 SGDID:S000002266 Length:306 Species:Saccharomyces cerevisiae


Alignment Length:281 Identity:89/281 - (31%)
Similarity:152/281 - (54%) Gaps:10/281 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILDIID 73
            |...:|:|||.:..|:........:::|||::........:.::.:||:|.||..:...::::||
Yeast     7 YTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELID 71

  Fly    74 IYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKPANLL 138
            |:.....|:||||:.|..|...:|.:....:...::.:.....:|:.:.|...::|||:||.|||
Yeast    72 IFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLL 136

  Fly   139 ISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVVAEML 203
            .|....:|:|||||||. .|.....|.| .|.||||||||:|||::.|.:.:|:|:.|.:.||::
Yeast   137 FSPDGQIKVADFGLARA-IPAPHEILTS-NVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELM 199

  Fly   204 RGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRF--PNSVGIHWDNLFPSCTHAV 266
            ..:|...|..|::|:.:..|.||:|....|||::|...|:|::.  |.|    .|.|......|.
Yeast   200 LRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYPPPS----RDELRKRFIAAS 260

  Fly   267 E--INLVSNLVVYNPKNRLKA 285
            |  ::.:..::..||:.|..|
Yeast   261 EYALDFMCGMLTMNPQKRWTA 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 89/281 (32%)
S_TKc 9..288 CDD:214567 89/281 (32%)
KIN28NP_010175.1 STKc_CDK7 7..302 CDD:270833 89/281 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0659
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.