DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6800 and CAK4

DIOPT Version :9

Sequence 1:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_176847.1 Gene:CAK4 / 842993 AraportID:AT1G66750 Length:348 Species:Arabidopsis thaliana


Alignment Length:276 Identity:106/276 - (38%)
Similarity:167/276 - (60%) Gaps:5/276 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILDII 72
            ||...:.:|||.:|.|:||.|.:..|.||:||:.|.|:...:....|||||.|:.....:|:::|
plant    12 RYLRRQILGEGTYGVVYKATDTKTGKTVAVKKIRLGNQKEGVNFTALREIKLLKELNHPHIVELI 76

  Fly    73 DIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKPANL 137
            |.:|....|.||.||....|...::.....||...::.:.....||:||.|:..::|||:||.||
plant    77 DAFPHDGSLHLVFEYMQTDLEAVIRDRNIFLSPGDIKSYMLMTLKGLAYCHKKWVLHRDMKPNNL 141

  Fly   138 LISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVVAEM 202
            ||.:..:||:||||||||:  ...:|.::.||...||||||:||||::||.|||:|||||:.||:
plant   142 LIGENGLLKLADFGLARLF--GSPNRRFTHQVFATWYRAPELLFGSRQYGAGVDVWAAGCIFAEL 204

  Fly   203 LRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHWDNLFPSCTHAVE 267
            |...|...|:|:|:||..|.:..|:|..:||.::..||||.:..:..:..:.  .:||..:... 
plant   205 LLRRPFLPGSTEIDQLGKIFQAFGTPVPSQWSDMIYLPDYMEFSYTPAPPLR--TIFPMASDDA- 266

  Fly   268 INLVSNLVVYNPKNRL 283
            ::|::.:.:|:|:.|:
plant   267 LDLLAKMFIYDPRQRI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 106/276 (38%)
S_TKc 9..288 CDD:214567 105/275 (38%)
CAK4NP_176847.1 STKc_CDK7 12..305 CDD:270833 106/276 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0659
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1367115at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.