DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6800 and CDKD1;3

DIOPT Version :9

Sequence 1:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_173244.1 Gene:CDKD1;3 / 838384 AraportID:AT1G18040 Length:391 Species:Arabidopsis thaliana


Alignment Length:280 Identity:110/280 - (39%)
Similarity:169/280 - (60%) Gaps:5/280 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILDII 72
            ||...|.:|:|.:|.||||.|.:..:.|||||:.|..:...:.:..|||||.|:..|..:|:.:|
plant    11 RYLKQEVLGQGTYGVVFKATDTKTEQTVAIKKIRLGKQREGVNITALREIKMLKELKHPHIILLI 75

  Fly    73 DIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKPANL 137
            |.:|....|.||.|:....|...::.....||...::.:....|||:||.|:..::|||:||.||
plant    76 DAFPHKENLHLVFEFMETDLEAVIRDSNIFLSPADIKSYLLMTFKGLAYCHDKWVLHRDMKPNNL 140

  Fly   138 LISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVVAEM 202
            ||.....||:|||||||::  ...:|.::.||..|||||||:|||:::||..||:||..|:.||:
plant   141 LIGVDGQLKLADFGLARIF--GSPNRKFTHQVFARWYRAPELLFGAKQYGAAVDVWAVACIFAEL 203

  Fly   203 LRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHWDNLFPSCTHAVE 267
            |...|...|.:||:||:.|....|:|:.:|||:||.||||.:.:|..:..:.  :|||:.:... 
plant   204 LLRRPFLQGNSDIDQLSKIFAAFGTPKADQWPDLTKLPDYVEYQFVPAPSLR--SLFPAVSDDA- 265

  Fly   268 INLVSNLVVYNPKNRLKASE 287
            ::|:|.:..|:||.|:...:
plant   266 LDLLSKMFTYDPKARISIKQ 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 110/280 (39%)
S_TKc 9..288 CDD:214567 109/279 (39%)
CDKD1;3NP_173244.1 STKc_CDK7 11..305 CDD:270833 110/280 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0659
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1367115at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.