DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6800 and cdk10

DIOPT Version :9

Sequence 1:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001017622.2 Gene:cdk10 / 550285 ZFINID:ZDB-GENE-050417-94 Length:360 Species:Danio rerio


Alignment Length:285 Identity:107/285 - (37%)
Similarity:170/285 - (59%) Gaps:17/285 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILDIID 73
            ::.:.:||||.:|.|::|.|.:.|:.||:|||.:..:...|.:::||||..|...:...|:::.:
Zfish    40 FEKINRIGEGTYGIVYRARDTRTNEIVALKKVRMDKEKDGIPISSLREINLLIRLRHPNIVELKE 104

  Fly    74 IY--PDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKPAN 136
            :.  ..|..|.||:.|....|.:.|::..:|.|..||:....|:.||:||||...::|||:|.:|
Zfish   105 VVVGSHLESLFLVMSYCEQDLASLLENMQSPFSEAQVKCIVLQLLKGLAYLHHNFILHRDLKVSN 169

  Fly   137 LLISDTDMLKIADFGLARLY-FPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVVA 200
            ||::|...:|||||||||:| .|   .:..:|:|.|.||||||:|.|::...|.:||||.||:.|
Zfish   170 LLMTDKGCVKIADFGLARVYGIP---LQPMTPRVVTLWYRAPELLLGTKTQTTALDMWAVGCIFA 231

  Fly   201 EMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLP---DYSKIRFPNSVGIHWDNLFPSC 262
            |:|...||..|.::|:||.:|::.||:|..:.||..:.||   .||..:.|      ::||....
Zfish   232 ELLAHKPLLPGASEIQQLDLIVQLLGTPNESIWPGFSRLPLVGQYSLRKQP------YNNLKNKF 290

  Fly   263 THAVE--INLVSNLVVYNPKNRLKA 285
            |...|  :.|::.|.:|||:.|..|
Zfish   291 TWLSEAGLRLLNLLFMYNPQRRATA 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 107/285 (38%)
S_TKc 9..288 CDD:214567 107/285 (38%)
cdk10NP_001017622.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.