DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6800 and Cdk2

DIOPT Version :9

Sequence 1:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster


Alignment Length:312 Identity:102/312 - (32%)
Similarity:163/312 - (52%) Gaps:33/312 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILDIID 73
            ::..||||||.:|.|:||......::||:||:.|:.:...:....:|||..|:..|...::.:.|
  Fly     8 FQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQLFD 72

  Fly    74 IYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKPANLL 138
            :......|.::.||....|...:..:.:..:.|.::.:.||:...:.:.|...::|||:||.|||
  Fly    73 VVISGNNLYMIFEYLNMDLKKLMDKKKDVFTPQLIKSYMHQILDAVGFCHTNRILHRDLKPQNLL 137

  Fly   139 ISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVVAEML 203
            :.....:|:|||||||.:  ....|.|:.:|.|.||||||||.|::.|.||||:|:.||:.:||:
  Fly   138 VDTAGKIKLADFGLARAF--NVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIFSEMI 200

  Fly   204 RGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHWD--NLFPSCTHAV 266
            ....||.|.::|:||..|.|||.:|....||.:|.|||: |.:||     .|:  |:....|...
  Fly   201 MRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDF-KTKFP-----RWEGTNMPQPITEHE 259

  Fly   267 EINLVSNLVVYNPKNRLKASE-----------------------VGSASSLT 295
            ...|:.:::.|:|..|:.|.:                       .||||.||
  Fly   260 AHELIMSMLCYDPNLRISAKDALQHAYFRNVQHVDHVALPVDPNAGSASRLT 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 100/310 (32%)
S_TKc 9..288 CDD:214567 96/303 (32%)
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 96/292 (33%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 96/286 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442458
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.