DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6800 and Cdk12

DIOPT Version :9

Sequence 1:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001262167.1 Gene:Cdk12 / 40385 FlyBaseID:FBgn0037093 Length:1157 Species:Drosophila melanogaster


Alignment Length:301 Identity:92/301 - (30%)
Similarity:150/301 - (49%) Gaps:35/301 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYIL---- 69
            ::|:.:||||.:|.|:||.|...|..||:|||.|:::.....:..:||||.|:......|:    
  Fly   804 FEMIAQIGEGTYGQVYKARDHHTNDMVALKKVRLEHEKEGFPITAVREIKILRQLNHRNIVNLHE 868

  Fly    70 ------DIIDIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLM 128
                  |.::...|.....||.||....|...|:|.:...:.:.......|:..|:.|.|:...:
  Fly   869 IVTDKQDAVEFRKDKGSFYLVFEYMDHDLMGLLESGMVDFNEENNASIMKQLLDGLNYCHKKNFL 933

  Fly   129 HRDIKPANLLISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMW 193
            |||||.:|:|:::...:|:|||||||||..:|..|.|:.:|.|.|||.||:|.|.::||..:|:|
  Fly   934 HRDIKCSNILMNNRGKVKLADFGLARLYNADDRERPYTNKVITLWYRPPELLLGEERYGPSIDVW 998

  Fly   194 AAGCVVAEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHWDNL 258
            :.||::.|:....|||....::.||..|.:..|||....||.:..||.:..::            
  Fly   999 SCGCILGELFVKRPLFQANAEMAQLETISKICGSPVPAVWPNVIKLPLFHTLK------------ 1051

  Fly   259 FPSCTH------------AVEINLVSNLVVYNPKNRLKASE 287
             ...||            |..::|:..::..:|..|:.|.:
  Fly  1052 -QKKTHRRRLREDFEFMPAPALDLLDKMLDLDPDKRITAED 1091

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 92/301 (31%)
S_TKc 9..288 CDD:214567 92/301 (31%)
Cdk12NP_001262167.1 STKc_CDK12 796..1098 CDD:270847 92/301 (31%)
S_TKc 804..1098 CDD:214567 92/301 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442466
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.