DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6800 and CG7028

DIOPT Version :9

Sequence 1:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001286884.1 Gene:CG7028 / 38032 FlyBaseID:FBgn0027587 Length:912 Species:Drosophila melanogaster


Alignment Length:228 Identity:67/228 - (29%)
Similarity:107/228 - (46%) Gaps:14/228 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SRYKMLEKIGEGVHGCVFKAIDLQRNK-EVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILD 70
            :||.:....|:||...|.:..|..|.: .||||.:..........|..|..:|.|.....|....
  Fly   590 NRYLVNGYTGQGVFSNVVRGRDQARGQANVAIKIIRNNEIMHKTGLRELEILKKLNDADPEDRFH 654

  Fly    71 IIDIYPDL---TGLSLVLEYQPDTLYNRLK---SEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMH 129
            .:.:|...   ..|.:|.|.....|...||   ..|. |..:.||.:..|:|..:..|.:.|::|
  Fly   655 CLRLYRHFFHKQHLCMVFEPLAMNLREVLKKYGKNVG-LHIKAVRSYTQQLFLALKLLKKTGILH 718

  Fly   130 RDIKPANLLISDTDM-LKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMW 193
            .||||.|:|:::.:: ||:.|||.|......:    .:|.:.:|:||:|||:.|. .|..|:|.|
  Fly   719 ADIKPDNILVNENNLILKLCDFGSASAISDNE----ITPYLVSRFYRSPEIILGI-PYDYGIDTW 778

  Fly   194 AAGCVVAEMLRGVPLFAGTTDIEQLAIIIRTLG 226
            :|||.:.|:..|..||:|.::.:.|...:...|
  Fly   779 SAGCTIYELYTGKILFSGKSNNQMLKFFMDVKG 811

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 67/227 (30%)
S_TKc 9..288 CDD:214567 66/226 (29%)
CG7028NP_001286884.1 STKc_PRP4 591..908 CDD:271037 67/227 (30%)
S_TKc 599..908 CDD:214567 65/219 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442433
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.