DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6800 and Cdc2rk

DIOPT Version :9

Sequence 1:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster


Alignment Length:289 Identity:103/289 - (35%)
Similarity:169/289 - (58%) Gaps:17/289 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SRYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILDI 71
            |.::.|.::|||.:|.|::|.|.:.|:.||:|||.:..:...:.::.||||..|:.|..|.|:.:
  Fly    51 SEFEKLNRVGEGSYGIVYRARDTRSNEIVALKKVRMDQEKDGLPISGLREIMILKQCHHENIVRL 115

  Fly    72 IDIY--PDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKP 134
            .::.  ..|..:.||:::....|.:.|.:...|.:..:|:....|:.|.:.|||...::|||:|.
  Fly   116 REVVVGKSLDSIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMIHRDLKV 180

  Fly   135 ANLLISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVV 199
            :|||::|...:|:|||||||::  .:..:..:||:.|.||||||:|.|.:.:.|.|||||.||::
  Fly   181 SNLLMTDKGCIKVADFGLARMF--SNPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCIL 243

  Fly   200 AEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLP---DYSKIRFPNSVGIHWDNLFPS 261
            .|:|.|.||..|.::|.||.:||..||:|..:.||....||   :::..:.|      ::||.|.
  Fly   244 GELLLGKPLLPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQNFTLSQQP------YNNLTPK 302

  Fly   262 CTHAV---EINLVSNLVVYNPKNRLKASE 287
             .|.:   ..||::.|.:||||.|..|.|
  Fly   303 -FHMIGQSGRNLLNILFIYNPKTRATAEE 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 102/288 (35%)
S_TKc 9..288 CDD:214567 102/287 (36%)
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 103/289 (36%)
S_TKc 53..337 CDD:214567 102/287 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442424
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.