DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6800 and Cdk1

DIOPT Version :9

Sequence 1:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster


Alignment Length:299 Identity:105/299 - (35%)
Similarity:168/299 - (56%) Gaps:29/299 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDYAPSRYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKS 65
            |||     ::.:||||||.:|.|:|..:....:.||:||:.|::....:....:|||..|:..|.
  Fly     1 MED-----FEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKH 60

  Fly    66 EYILDIIDIYPDLTGLSLVLEYQPDTLYNRLKSEVNPL------SRQQVRKFAHQMFKGIAYLHE 124
            |.|:.:.|:..:...:.|:.|:    |...||..::.|      ..:.||.:.:|:...|.:.|.
  Fly    61 ENIVCLEDVLMEENRIYLIFEF----LSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHR 121

  Fly   125 AGLMHRDIKPANLLISDTDMLKIADFGLARLY-FPEDESRLYSPQVSTRWYRAPEILFGSQKYGT 188
            ..::|||:||.||||..:.::|:|||||.|.: .|   .|:|:.::.|.||||||:|.||.:|..
  Fly   122 RRVLHRDLKPQNLLIDKSGLIKVADFGLGRSFGIP---VRIYTHEIVTLWYRAPEVLLGSPRYSC 183

  Fly   189 GVDMWAAGCVVAEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFP----N 249
            .||:|:.||:.|||....|||.|.::|:||..:.|.|.:|..:.||.:|||||| |..||    |
  Fly   184 PVDIWSIGCIFAEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDY-KNTFPCWSTN 247

  Fly   250 SVGIHWDNLFPSCTHAVEINLVSNLVVYNPKNRLKASEV 288
            .:.....||     .|..|:|:..:::|:|.:|:.|.::
  Fly   248 QLTNQLKNL-----DANGIDLIQKMLIYDPVHRISAKDI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 102/292 (35%)
S_TKc 9..288 CDD:214567 102/289 (35%)
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 103/297 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442459
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.