DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6800 and Cdk7

DIOPT Version :9

Sequence 1:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_511044.1 Gene:Cdk7 / 31441 FlyBaseID:FBgn0263237 Length:353 Species:Drosophila melanogaster


Alignment Length:283 Identity:111/283 - (39%)
Similarity:171/283 - (60%) Gaps:8/283 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKV---ALKNKFGNIALNTLREIKTLQLCKSEYIL 69
            ||..|..:|||....|:||.|...|:.||:||:   :.::....|....|||||.||..:.|.|:
  Fly    11 RYAKLSFLGEGQFATVYKARDTVTNQIVAVKKIKKGSREDARDGINRTALREIKILQELQHENII 75

  Fly    70 DIIDIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKP 134
            .::|::..|:.:|||.::....|...:|.....|::..::.:|....||:.|||...::|||:||
  Fly    76 GLVDVFGQLSNVSLVFDFMDTDLEVIIKDNKIILTQANIKAYAIMTLKGLEYLHLNWILHRDLKP 140

  Fly   135 ANLLISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVV 199
            .|||::...:|||.|||||:.:  ...:|:|:..|.|||||:||:|||:::|||||||||.||::
  Fly   141 NNLLVNSDGILKIGDFGLAKSF--GSPNRIYTHHVVTRWYRSPELLFGARQYGTGVDMWAVGCIL 203

  Fly   200 AEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHWDNLFPSCTH 264
            ||::..||...|.:|::||..|..|||:|...:||.|:.|.||  ::|.|..|...||:|.:..:
  Fly   204 AELMLRVPFMPGDSDLDQLTRIFSTLGTPTEAEWPHLSKLHDY--LQFRNFPGTPLDNIFTAAGN 266

  Fly   265 AVEINLVSNLVVYNPKNRLKASE 287
            .: |:|:..|...||..|:...|
  Fly   267 DL-IHLMQRLFAMNPLRRVSCRE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 111/283 (39%)
S_TKc 9..288 CDD:214567 110/282 (39%)
Cdk7NP_511044.1 PTZ00024 6..308 CDD:240233 111/283 (39%)
STKc_CDK7 11..308 CDD:270833 111/283 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442391
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0659
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1367115at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.