DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6800 and ppk23

DIOPT Version :9

Sequence 1:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_595739.1 Gene:ppk23 / 2540799 PomBaseID:SPBC18H10.15 Length:398 Species:Schizosaccharomyces pombe


Alignment Length:299 Identity:101/299 - (33%)
Similarity:160/299 - (53%) Gaps:40/299 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILDI-- 71
            |::||||.||.:|.|::.:|...|..||:||:..........:.:||||::|...:.:.|:::  
pombe    74 YEILEKIEEGSYGIVYRGLDKSTNTLVALKKIKFDPNGIGFPITSLREIESLSSIRHDNIVELEK 138

  Fly    72 IDIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKPAN 136
            :.:..||..:.||:|:....|...|.:......:.:|:....|:....|::|....:|||:||:|
pombe   139 VVVGKDLKDVYLVMEFMEHDLKTLLDNMPEDFLQSEVKTLMLQLLAATAFMHHHWYLHRDLKPSN 203

  Fly   137 LLISDTDMLKIADFGLARLYFPEDE-----SRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAG 196
            ||:::|..:|:|||||||   |..|     :||    |.|.||||||:|.|:..||..:|||:.|
pombe   204 LLMNNTGEIKLADFGLAR---PVSEPKSSLTRL----VVTLWYRAPELLLGAPSYGKEIDMWSIG 261

  Fly   197 CVVAEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPEL-----------TSLPDYSKIR--FP 248
            |:.|||:...|||:|.::::||..|...||.|...:||:.           .::|.:||||  .|
pombe   262 CIFAEMITRTPLFSGKSELDQLYKIFNLLGYPTREEWPQYFLLPYANKIKHPTVPTHSKIRTSIP 326

  Fly   249 NSVGIHWDNLFPSCTHAVEINLVSNLVVYNPKNRLKASE 287
            |..|..:|             |::.|:..||..|:.|.|
pombe   327 NLTGNAYD-------------LLNRLLSLNPAKRISAKE 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 101/299 (34%)
S_TKc 9..288 CDD:214567 101/299 (34%)
ppk23NP_595739.1 STKc_CDC2L1 68..359 CDD:173741 101/299 (34%)
PLN00009 71..361 CDD:177649 101/299 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.