DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6800 and cdc2

DIOPT Version :9

Sequence 1:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001342995.1 Gene:cdc2 / 2539869 PomBaseID:SPBC11B10.09 Length:297 Species:Schizosaccharomyces pombe


Alignment Length:297 Identity:109/297 - (36%)
Similarity:165/297 - (55%) Gaps:36/297 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSE----YIL 69
            |:.:||||||.:|.|:||......:.||:||:.|:::...:....:|||..|:....|    ..:
pombe     4 YQKVEKIGEGTYGVVYKARHKLSGRIVAMKKIRLEDESEGVPSTAIREISLLKEVNDENNRSNCV 68

  Fly    70 DIIDIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSR--------QQVRKFAHQMFKGIAYLHEAG 126
            .::||....:.|.||.|:    |...||..::.:|.        :.|:||.:|:..|:.:.|...
pombe    69 RLLDILHAESKLYLVFEF----LDMDLKKYMDRISETGATSLDPRLVQKFTYQLVNGVNFCHSRR 129

  Fly   127 LMHRDIKPANLLISDTDMLKIADFGLARLY-FPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGV 190
            ::|||:||.||||.....||:|||||||.: .|   .|.|:.::.|.||||||:|.||:.|.|||
pombe   130 IIHRDLKPQNLLIDKEGNLKLADFGLARSFGVP---LRNYTHEIVTLWYRAPEVLLGSRHYSTGV 191

  Fly   191 DMWAAGCVVAEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHW 255
            |:|:.||:.|||:|..|||.|.::|:::..|.:.||:|....||.:|.|.|| |..||     .|
pombe   192 DIWSVGCIFAEMIRRSPLFPGDSEIDEIFKIFQVLGTPNEEVWPGVTLLQDY-KSTFP-----RW 250

  Fly   256 DNLFPSCTHAV-------EINLVSNLVVYNPKNRLKA 285
            ..:   ..|.|       .|.|:|.::||:|.:|:.|
pombe   251 KRM---DLHKVVPNGEEDAIELLSAMLVYDPAHRISA 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 109/297 (37%)
S_TKc 9..288 CDD:214567 109/297 (37%)
cdc2NP_001342995.1 STKc_CDK1_CdkB_like 4..293 CDD:270829 109/297 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.