DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6800 and cdk-11.1

DIOPT Version :9

Sequence 1:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_495617.1 Gene:cdk-11.1 / 174244 WormBaseID:WBGene00015203 Length:719 Species:Caenorhabditis elegans


Alignment Length:310 Identity:91/310 - (29%)
Similarity:157/310 - (50%) Gaps:56/310 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILDIID 73
            |:.:.::.||..|.|::..|.:.::.||:|::.::.:.....:..||||.  .|.|:....:|::
 Worm   356 YECVNRVDEGTFGVVYRGKDKRTDEIVALKRLKMEKEKEGFPITALREIN--MLLKAGNHPNIVN 418

  Fly    74 IYPDLTGLSLVLEYQPDTLY-------NRLKSEVNPLSRQQVR-------KFAHQMFKGIAYLHE 124
            :...|.|.::      |.:|       :.:||.::.:||:..|       ....|:..||.::|:
 Worm   419 VKEILLGSNM------DKIYMAMEFVEHDMKSLLDTMSRRNKRFSIGEQKTLLQQLLSGIEHMHK 477

  Fly   125 AGLMHRDIKPANLLISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTG 189
            ..::|||:|.:|||:|...:||||||||||.|  .|..:.::..|.|.|||:||:|.|::.|.|.
 Worm   478 LWILHRDLKTSNLLMSHKGILKIADFGLAREY--GDPLKKFTSIVVTLWYRSPELLLGTRLYSTP 540

  Fly   190 VDMWAAGCVVAEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFP------ 248
            ||||:.||::||.:...|||.|..::||:..|...:|:|..:.||.:|.|..:..:.|.      
 Worm   541 VDMWSVGCIMAEFILLKPLFPGRGELEQIKKIFMEMGTPTESIWPGVTELDGWKALTFEKYPYNQ 605

  Fly   249 -----------NSVGIHWDNLFPSCTHAVEINLVSNLVVYNPKNRLKASE 287
                       |..|               ..|::.|:..:||||..|::
 Worm   606 LRKRFLAGRLLNDTG---------------FKLLNGLLTLDPKNRFSATQ 640

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 91/310 (29%)
S_TKc 9..288 CDD:214567 91/310 (29%)
cdk-11.1NP_495617.1 STKc_CDC2L1 350..647 CDD:173741 91/310 (29%)
PLN00009 353..647 CDD:177649 91/310 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.