DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6800 and Cdk5

DIOPT Version :9

Sequence 1:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_543161.1 Gene:Cdk5 / 140908 RGDID:70514 Length:292 Species:Rattus norvegicus


Alignment Length:291 Identity:111/291 - (38%)
Similarity:162/291 - (55%) Gaps:25/291 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILDII 72
            :|:.|||||||.:|.||||.:.:.::.||:|:|.|.:....:..:.||||..|:..|.:.|:.:.
  Rat     3 KYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLH 67

  Fly    73 DIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKPANL 137
            |:......|:||.|:....|.....|....|..:.|:....|:.||:.:.|...::|||:||.||
  Rat    68 DVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSLLFQLLKGLGFCHSRNVLHRDLKPQNL 132

  Fly   138 LISDTDMLKIADFGLARLY-FPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVVAE 201
            ||:....||:|||||||.: .|   .|.||.:|.|.|||.|::|||::.|.|.:|||:|||:.||
  Rat   133 LINRNGELKLADFGLARAFGIP---VRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAE 194

  Fly   202 MLR-GVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHWDNLFPSCTHA 265
            :.. |.|||.|....:||..|.|.||:|...|||.:|.||||..  :|         ::|:.|..
  Rat   195 LANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPAMTKLPDYKP--YP---------MYPATTSL 248

  Fly   266 VEI---------NLVSNLVVYNPKNRLKASE 287
            |.:         :|:.||:..||..|:.|.|
  Rat   249 VNVVPKLNATGRDLLQNLLKCNPVQRISAEE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 111/291 (38%)
S_TKc 9..288 CDD:214567 111/290 (38%)
Cdk5NP_543161.1 STKc_CDK5 3..286 CDD:143344 111/291 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.