DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6800 and Cdk5

DIOPT Version :9

Sequence 1:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_031694.1 Gene:Cdk5 / 12568 MGIID:101765 Length:292 Species:Mus musculus


Alignment Length:291 Identity:112/291 - (38%)
Similarity:163/291 - (56%) Gaps:25/291 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILDII 72
            :|:.|||||||.:|.||||.:.:.::.||:|:|.|.:....:..:.||||..|:..|.:.|:.:.
Mouse     3 KYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLH 67

  Fly    73 DIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKPANL 137
            |:......|:||.|:....|.....|....|..:.|:.|..|:.||:.:.|...::|||:||.||
Mouse    68 DVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNL 132

  Fly   138 LISDTDMLKIADFGLARLY-FPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVVAE 201
            ||:....||:|||||||.: .|   .|.||.:|.|.|||.|::|||::.|.|.:|||:|||:.||
Mouse   133 LINRNGELKLADFGLARAFGIP---VRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAE 194

  Fly   202 MLR-GVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHWDNLFPSCTHA 265
            :.. |.|||.|....:||..|.|.||:|...|||.:|.||||..  :|         ::|:.|..
Mouse   195 LANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPAMTKLPDYKP--YP---------MYPATTSL 248

  Fly   266 VEI---------NLVSNLVVYNPKNRLKASE 287
            |.:         :|:.||:..||..|:.|.|
Mouse   249 VNVVPKLNATGRDLLQNLLKCNPVQRISAEE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 112/291 (38%)
S_TKc 9..288 CDD:214567 112/290 (39%)
Cdk5NP_031694.1 STKc_CDK5 3..286 CDD:143344 112/291 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.