DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6800 and Cdk20

DIOPT Version :9

Sequence 1:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_444410.1 Gene:Cdk20 / 105278 MGIID:2145349 Length:346 Species:Mus musculus


Alignment Length:281 Identity:122/281 - (43%)
Similarity:180/281 - (64%) Gaps:3/281 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQ-LCKSEYILDI 71
            :|.:|.:||||.||.||||..::..:.||:|||||:.....|....|||||.|| :..|:|::.:
Mouse     3 QYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGIPNQALREIKALQEIEDSQYVVQL 67

  Fly    72 IDIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKPAN 136
            ..::|...|..|..|:....|...::....||:..||:.:...:.||:|:.|...::|||:||||
Mouse    68 KAVFPHGAGFVLAFEFMLSDLAEVVRHAQRPLAPAQVKSYLQMLLKGVAFCHANNIVHRDLKPAN 132

  Fly   137 LLISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVVAE 201
            ||||.:..||||||||||::.| |..|||:.||:||||||||:|:|:::|..|||:||.||::.|
Mouse   133 LLISASGQLKIADFGLARVFSP-DGGRLYTHQVATRWYRAPELLYGARQYDQGVDLWAVGCIMGE 196

  Fly   202 MLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHWDNLFPSCTHAV 266
            :|.|.|||.|..|||||..::|.||:|....|||:|.||||:||.|.....:..:.:.|..:...
Mouse   197 LLNGSPLFPGENDIEQLCCVLRILGTPSPRVWPEITELPDYNKISFKEQAPVPLEEVLPDASPQA 261

  Fly   267 EINLVSNLVVYNPKNRLKASE 287
             ::|:...::|.|:.|:.||:
Mouse   262 -LDLLGQFLLYPPRQRIAASQ 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 122/281 (43%)
S_TKc 9..288 CDD:214567 122/280 (44%)
Cdk20NP_444410.1 STKc_CCRK 3..289 CDD:270826 122/281 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..324
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846904
Domainoid 1 1.000 243 1.000 Domainoid score I2210
eggNOG 1 0.900 - - E1_KOG0659
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H8109
Inparanoid 1 1.050 245 1.000 Inparanoid score I3273
Isobase 1 0.950 - 0 Normalized mean entropy S900
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1367115at2759
OrthoFinder 1 1.000 - - FOG0008130
OrthoInspector 1 1.000 - - oto94981
orthoMCL 1 0.900 - - OOG6_106079
Panther 1 1.100 - - LDO PTHR24056
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5375
SonicParanoid 1 1.000 - - X6084
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.