DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6800 and CDK2

DIOPT Version :9

Sequence 1:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_011536034.1 Gene:CDK2 / 1017 HGNCID:1771 Length:346 Species:Homo sapiens


Alignment Length:331 Identity:105/331 - (31%)
Similarity:160/331 - (48%) Gaps:63/331 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILDIID 73
            ::.:||||||.:|.|:||.:....:.||:||:.|..:...:....:|||..|:......|:.::|
Human     4 FQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLD 68

  Fly    74 IYPDLTGLSLVLEYQPDTLYNRLK-----SEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIK 133
            :......|.||.|:    |:..||     |.:..:....::.:..|:.:|:|:.|...::|||:|
Human    69 VIHTENKLYLVFEF----LHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLK 129

  Fly   134 PANLLISDTDMLKIADFGLARLY-FPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGC 197
            |.||||:....:|:|||||||.: .|   .|.|:.:|.|.||||||||.|.:.|.|.||:|:.||
Human   130 PQNLLINTEGAIKLADFGLARAFGVP---VRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGC 191

  Fly   198 VVAEM-LRGV-----------------------------------------------PLFAGTTD 214
            :.||| |.|.                                               .||.|.::
Human   192 IFAEMHLVGTQHHARCCGEHRRNGRQSLCPLCSYLEVAASQGWGMTAVSTPYPVTRRALFPGDSE 256

  Fly   215 IEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHWDNLFPSCTHAVEINLVSNLVVYNP 279
            |:||..|.||||:|....||.:||:||| |..||......:..:.|....... :|:|.::.|:|
Human   257 IDQLFRIFRTLGTPDEVVWPGVTSMPDY-KPSFPKWARQDFSKVVPPLDEDGR-SLLSQMLHYDP 319

  Fly   280 KNRLKA 285
            ..|:.|
Human   320 NKRISA 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 105/331 (32%)
S_TKc 9..288 CDD:214567 105/331 (32%)
CDK2XP_011536034.1 STKc_CDK2_3 3..334 CDD:270844 105/331 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.