DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Burs and CSS1

DIOPT Version :9

Sequence 1:NP_650983.1 Gene:Burs / 42560 FlyBaseID:FBgn0038901 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_012097.1 Gene:CSS1 / 854637 SGDID:S000001431 Length:995 Species:Saccharomyces cerevisiae


Alignment Length:123 Identity:25/123 - (20%)
Similarity:40/123 - (32%) Gaps:20/123 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TAQPDSSVAATDNDITHLGDDCQVTPVIHVLQYPGCVPKPIPSFACVGRCASYIQVSGSKIWQME 95
            ||.|.|....|   :||..|:             ||..|.:.|.|  ....:...||...  ...
Yeast   756 TASPKSYTTVT---VTHCDDN-------------GCNTKTVTSEA--PEATTTTTVSSQS--YTT 800

  Fly    96 RSCMCCQESGEREAAVSLFCPKVKPGERKFKKVLTKAPLECMCRPCTSIEESGIIPQE 153
            .:...|.::|.:...|:...|:........|...|....:|....|::...:...|:|
Yeast   801 ATVTHCDDNGCKTKTVTSEAPEATTTTVSPKTYTTATVTQCDDNGCSTKTVTSECPEE 858

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BursNP_650983.1 GHB_like 50..138 CDD:419725 15/87 (17%)
CSS1NP_012097.1 Hyphal_reg_CWP 313..596 CDD:371712
PRK12355 627..>977 CDD:237072 25/123 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.