DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Burs and HPF1

DIOPT Version :9

Sequence 1:NP_650983.1 Gene:Burs / 42560 FlyBaseID:FBgn0038901 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_014487.1 Gene:HPF1 / 854010 SGDID:S000005515 Length:967 Species:Saccharomyces cerevisiae


Alignment Length:187 Identity:37/187 - (19%)
Similarity:55/187 - (29%) Gaps:53/187 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VFVLILLYC-----VLVS----------ILKLCTAQPDSSVAATDNDITHLGDDCQVT------- 55
            |:...|.|.     |:||          :..:.|..|.||..||.......|  |.||       
Yeast   678 VYTTTLTYATTTSTVVVSCSETTDSNGNVYTITTTVPCSSTTATITSCDETG--CHVTTSTGTVA 740

  Fly    56 ------------PVIHVLQYPGCVPKPIPS------FACVGRCASYIQVSGSKIWQMERSCMCCQ 102
                        .|.| ....||..|.:.|      .|......||..|:.:.          |.
Yeast   741 TETVSSKSYTTVTVTH-CDNNGCNTKTVTSECPEETSATTTSPKSYTTVTVTH----------CD 794

  Fly   103 ESGEREAAVSLFCPKVKPGERKFKKVLTKAPLECMCRPCTSIEESGIIPQEIAGYSD 159
            ::|.....|:...|:........|...|....:|....|::...:...|:|.:..|:
Yeast   795 DNGCNTKTVTSEAPEATTTTVSPKTYTTATVTQCDDNGCSTKTVTSEAPKETSETSE 851

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BursNP_650983.1 GHB_like 50..138 CDD:419725 20/112 (18%)
HPF1NP_014487.1 Hyphal_reg_CWP 337..617 CDD:403079
Herpes_BLLF1 <643..937 CDD:282904 37/187 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.