DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Burs and FRAS1

DIOPT Version :9

Sequence 1:	NP_650983.1	Gene:	Burs / 42560	FlyBaseID:	FBgn0038901	Length:	173	Species:	Drosophila melanogaster
Sequence 2:	NP_079350.5	Gene:	FRAS1 / 80144	HGNCID:	19185	Length:	4012	Species:	Homo sapiens

Alignment Length:	104	Identity:	21/104 - (20%)
Similarity:	37/104 - (35%)	Gaps:	31/104 - (29%)

- Green bases have known domain annotations that are detailed below.

  Fly    66 CVPKPIPSFAC-------------------VGRCASY---IQVSGSKIWQMERSCMCCQESGERE 108
            |.|:|.|..:|                   :|:..||   :...|.. |::.|...|...:|..:
Human   125 CTPQPCPPLSCGHQELAFIPEGSCCPVCVGLGKPCSYEGHVFQDGED-WRLSRCAKCLCRNGVAQ 188

  Fly   109 AAVS----LFCPKVKPGERKFKKVLTKAPLECMCRPCTS 143
            ...:    |||.:    :....:|..|...:|..|.|::
Human   189 CFTAQCQPLFCNQ----DETVVRVPGKCCPQCSARSCSA 223

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Burs	NP_650983.1	GHB_like	50..138	CDD:419725	19/97 (20%)
FRAS1	NP_079350.5	VWC	28..87	CDD:214564
		VWC	95..152	CDD:278520	5/26 (19%)
		VWC	159..216	CDD:278520	12/61 (20%)
		VWC	221..278	CDD:278520	1/3 (33%)
		VWC	285..342	CDD:214564
		VWC	367..416	CDD:214564
		FU 1	409..460
		Furin-like	462..620	CDD:279142
		FU 2	462..505
		FU	462..504	CDD:214589
		FU 3	507..553
		FU	507..552	CDD:214589
		FU 4	555..599
		FU	556..598	CDD:214589
		FU 5	602..647
		FU	608..653	CDD:238021
		FU 6	649..705
		FU	650..704	CDD:214589
		GF_recep_IV	655..777	CDD:291509
		FU 7	708..753
		FU	708..752	CDD:214589
		FU 8	755..800
		FU	755..799	CDD:214589
		FU 9	803..852
		FU	804..851	CDD:214589
		Furin-like	841..1056	CDD:279142
		FU 10	854..900
		FU	859..907	CDD:238021
		FU 11	903..948
		FU 12	952..997
		FU	952..996	CDD:214589
		FU 13	999..1042
		FU	999..1041	CDD:214589
		Furin-like_2	1009..1099	CDD:292535
		FU 14	1046..1089
		FU	1046..1087	CDD:214589
		Cadherin_3	<1101..1183	CDD:292802
		CSPG 1. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01201	1102..1197
		Cadherin_3	1168..1310	CDD:292802
		CSPG 2. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01201	1217..1308
		Cadherin_3	1279..1438	CDD:292802
		CSPG 3. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01201	1329..1438
		Cadherin_3	1409..1574	CDD:292802
		CSPG 4. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01201	1463..1559
		Cadherin_3	1529..1691	CDD:292802
		CSPG 5. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01201	1595..1689
		Cadherin_3	1660..1811	CDD:292802
		CSPG 6. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01201	1710..1810
		Cadherin_3	1778..1938	CDD:292802
		CSPG 7. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01201	1833..1936
		Cadherin_3	1904..2059	CDD:292802
		CSPG 8. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01201	1957..2057
		Cadherin_3	2028..2179	CDD:292802
		CSPG 9. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01201	2078..2177
		Cadherin_3	2147..2293	CDD:292802
		CSPG 10. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01201	2199..2291
		Cadherin_3	2261..2406	CDD:292802
		CSPG 11. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01201	2311..2404
		Cadherin_3	2375..2537	CDD:292802
		CSPG 12. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01201	2439..2536
		Calx_beta	2555..2650	CDD:197594
		Calx-beta	2675..2764	CDD:295344
		Calx-beta	2798..2894	CDD:295344
		Calx-beta	2920..3011	CDD:295344
Calx-beta	3039..3133	CDD:295344
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1216
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900