DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Burs and Muc5b

DIOPT Version :9

Sequence 1:	NP_650983.1	Gene:	Burs / 42560	FlyBaseID:	FBgn0038901	Length:	173	Species:	Drosophila melanogaster
Sequence 2:	NP_083077.2	Gene:	Muc5b / 74180	MGIID:	1921430	Length:	4800	Species:	Mus musculus

Alignment Length:	100	Identity:	33/100 - (33%)
Similarity:	49/100 - (49%)	Gaps:	8/100 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly    52 CQVTPVIHVLQYPGCVPKPIPSFACVGRCASYIQVSGSKIWQMERSCMCCQESGEREAAVSLFCP 116
            |||.....||:|.||..:...:| |.|.|:...:.| .:...|||.|.|||||...:.||::.||
Mouse  4706 CQVHVNATVLRYKGCETEVNITF-CEGSCSGISKYS-MEAQAMERQCTCCQESKVHDVAVTMQCP 4768

  Fly   117 KVKPGERKFKKVLTKAPLECMCRP-CTSIEESGII 150
            .....:..:..:     .||.|.| |:|:..:.:|
Mouse  4769 DGTVIQHTYTHI-----DECNCAPACSSLPGTSMI 4798

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Burs	NP_650983.1	GHB_like	50..138	CDD:419725	28/85 (33%)
Muc5b	NP_083077.2	VWD	80..227	CDD:214566
		C8	263..329	CDD:285899
		TIL	333..389	CDD:280072
		VWC_out	391..>436	CDD:214565
		VWD	418..582	CDD:214566
		C8	619..700	CDD:214843
		TIL	710..756	CDD:280072
		TIL	798..859	CDD:280072
		VWD	888..1047	CDD:214566
		C8	1087..1157	CDD:285899
		Mucin2_WxxW	1345..1432	CDD:290069
		Mucin2_WxxW	1574..1663	CDD:290069
		NUDE_C	<1676..1796	CDD:282704
		Mucin2_WxxW	1870..1959	CDD:290069
		Mucin2_WxxW	2184..2273	CDD:290069
		Mucin2_WxxW	2498..2587	CDD:290069
		Mucin2_WxxW	2687..2776	CDD:290069
		Herpes_BLLF1	<2920..3410	CDD:282904
		Mucin2_WxxW	3066..3155	CDD:290069
		Mucin2_WxxW	3380..3469	CDD:290069
		PHA03255	3475..>3621	CDD:165513
		Mucin2_WxxW	3625..3713	CDD:290069
		Mucin2_WxxW	3779..3867	CDD:290069
		VWD	4111..4283	CDD:214566
		C8	4336..4398	CDD:285899
		VWC	4570..4631	CDD:214564
		CT	4708..4790	CDD:214482	28/88 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1216
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S12596
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.760