DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Burs and Bmper

DIOPT Version :9

Sequence 1:NP_650983.1 Gene:Burs / 42560 FlyBaseID:FBgn0038901 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_082748.1 Gene:Bmper / 73230 MGIID:1920480 Length:685 Species:Mus musculus


Alignment Length:177 Identity:41/177 - (23%)
Similarity:59/177 - (33%) Gaps:48/177 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VLILLYCVLVSILKLCTAQPDSSVAATDNDITHLGDDCQVTPVIHVLQYPGCVPKPIPSFACVGR 79
            ||:||.|..|. :.|.::....|||..:|:    |:         |||.|.....|.....|:.:
Mouse    25 VLLLLNCSGVP-MSLASSFLTGSVAKCENE----GE---------VLQIPFITDNPCIMCVCLNK 75

  Fly    80 ---------------CASYIQVSGSKIWQMERSCMCCQESGE-----------REAAVSLFCPKV 118
                           ||..|:..|:   ..|| |..|...|.           .|..|...|.:.
Mouse    76 EVTCKREKCPVLSRDCALAIKQRGA---CCER-CKGCTHEGRTYNSSFKWQTPAEPCVLRQCQEG 136

  Fly   119 KPGERKFKKVL-TKAPLE---CMCRPCTSIEESGIIPQEIAGYSDEG 161
            ...|.:.:.|: .|.|.|   ..|..|......|:..:|...:..||
Mouse   137 VVTESEVRCVVHCKNPAEHQGACCPTCPGCVFEGVQYREGEEFQPEG 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BursNP_650983.1 GHB_like 50..138 CDD:419725 23/117 (20%)
BmperNP_082748.1 VWC 166..224 CDD:278520 4/18 (22%)
VWC 301..357 CDD:302663
VWD 364..508 CDD:278521
C8 556..624 CDD:285899
TIL 629..682 CDD:280072
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.