DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Burs and MUC5B

DIOPT Version :9

Sequence 1:	NP_650983.1	Gene:	Burs / 42560	FlyBaseID:	FBgn0038901	Length:	173	Species:	Drosophila melanogaster
Sequence 2:	NP_002449.2	Gene:	MUC5B / 727897	HGNCID:	7516	Length:	5762	Species:	Homo sapiens

Alignment Length:	140	Identity:	38/140 - (27%)
Similarity:	53/140 - (37%)	Gaps:	16/140 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly    10 NNKVFVLILLYCVLVSILKLCTAQPDS--SVAATDNDITHLG-------DDCQVTPVIHVLQYPG 65
            |:.|....:..|.....:.|.|.||.|  .|::....:...|       |.|||.....:|.:.|
Human  5607 NSHVDNCTVYLCEAEGGVHLLTPQPASCPDVSSCRGSLRKTGCCYSCEEDSCQVRINTTILWHQG 5671

  Fly    66 CVPKPIPSFACVGRCASYIQVSGSKIWQMERSCMCCQESGEREAAVSLFCPKVKPGERKFKKVLT 130
            |..:...:| |.|.|....:.| ::...|:..|.||||....|..|.|.||........:..|
Human  5672 CETEVNITF-CEGSCPGASKYS-AEAQAMQHQCTCCQERRVHEETVPLHCPNGSAILHTYTHV-- 5732

  Fly   131 KAPLECMCRP 140
               .||.|.|
Human  5733 ---DECGCTP 5739

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Burs	NP_650983.1	GHB_like	50..138	CDD:419725	26/87 (30%)
MUC5B	NP_002449.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	27..50
		VWD	70..223	CDD:214566
		C8	270..325	CDD:285899
		TIL	329..385	CDD:280072
		VWC_out	387..>432	CDD:214565
		VWD	414..578	CDD:214566
		C8	615..685	CDD:214843
		TIL	695..752	CDD:280072
		TIL	794..855	CDD:280072
		VWD	884..1041	CDD:214566
		C8	1078..1152	CDD:214843
		7 X Cys-rich subdomain repeats	1333..4228
		Mucin2_WxxW	1340..1426	CDD:290069
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1437..1462
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1480..1502
		Mucin2_WxxW	1508..1597	CDD:290069
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1607..1783
		Mucin2_WxxW	1789..1878	CDD:290069
		11 X approximate tandem repeats, Ser/Thr-rich	1890..2199
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1890..2019
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2031..2100
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2114..2211
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2242..2302
		Mucin2_WxxW	2320..2408	CDD:290069
		11 X approximate tandem repeats, Ser/Thr-rich	2419..2756
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2443..2462
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2473..2522
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2556..2861
		PARM	2675..>2860	CDD:293666
		Mucin2_WxxW	2877..2965	CDD:290069
		17 X approximate tandem repeats, Ser/Thr-rich	2976..3456
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	3001..3049
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	3256..3357
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	3371..3469
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	3481..3561
		Mucin2_WxxW	3577..3665	CDD:290069
		11 X approximate tandem repeats, Ser/Thr-rich	3676..4013
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	3699..3779
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	3813..3917
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	3956..4118
		Mucin2_WxxW	4134..4222	CDD:290069
		23 X approximate tandem repeats, Ser/Thr-rich	4233..4879
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	4259..4389
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	4428..4447
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	4458..4527
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	4541..4750
		VWD	5064..5237	CDD:214566
		C8	5290..5351	CDD:285899
		VWC	5523..5586	CDD:214564
		CT	5660..5742	CDD:214482	25/87 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1216
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900