DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Burs and Dand5

DIOPT Version :9

Sequence 1:NP_650983.1 Gene:Burs / 42560 FlyBaseID:FBgn0038901 Length:173 Species:Drosophila melanogaster
Sequence 2:XP_001064979.1 Gene:Dand5 / 685719 RGDID:1590249 Length:184 Species:Rattus norvegicus


Alignment Length:94 Identity:25/94 - (26%)
Similarity:41/94 - (43%) Gaps:4/94 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LGDDCQVTPVIHVLQYPGCVPKPIPSFACVGRCAS-YIQVSGSKIWQMERSCMCCQESGEREAAV 111
            |.:.|:..|.:.|:..|||....:.:..|.|.|:| ||..|......:   |..|..|..|..:|
  Rat    92 LQETCKALPFVQVISRPGCTSARVLNHLCFGHCSSFYIPSSDPSPVVL---CNSCVPSRRRWTSV 153

  Fly   112 SLFCPKVKPGERKFKKVLTKAPLECMCRP 140
            :|:|...:....:..::.|....:|.|.|
  Rat   154 ALWCGAGQSASPRRVRISTVLVQKCQCHP 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BursNP_650983.1 GHB_like 50..138 CDD:419725 22/88 (25%)
Dand5XP_001064979.1 GHB_like 84..180 CDD:419725 23/90 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.