DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Burs and becn1

DIOPT Version :9

Sequence 1:NP_650983.1 Gene:Burs / 42560 FlyBaseID:FBgn0038901 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001029112.1 Gene:becn1 / 619357 XenbaseID:XB-GENE-999318 Length:445 Species:Xenopus tropicalis


Alignment Length:109 Identity:27/109 - (24%)
Similarity:41/109 - (37%) Gaps:20/109 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SFACVGRCASYIQVSGS-KIWQMERSCMCCQESGEREAAVSLFCPKVKPG---------ERKFKK 127
            ||.| .||:..:::..| ||  :::..|      :...|..:....||||         |..|.:
 Frog    12 SFVC-QRCSQPLKLDTSFKI--LDKVTM------QELTAPLVTTAAVKPGDIQEVDSNIEETFAE 67

  Fly   128 VLTKAPLECMCRPCTSIE-ESGIIPQEIAGYSDEGPLNNHFRRI 170
            ..|......:..|...:. ||......|...||.|.:.|..||:
 Frog    68 NRTDGVSRRLIPPARMMSTESATSFTLIGEASDGGTMENLSRRL 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BursNP_650983.1 GHB_like 50..138 CDD:419725 17/74 (23%)
becn1NP_001029112.1 BH3 102..124 CDD:373713 4/10 (40%)
BH3. /evidence=ECO:0000250 103..122 3/9 (33%)
APG6_N 130..256 CDD:375248
Evolutionary conserved domain (ECD). /evidence=ECO:0000250|UniProtKB:Q14457 240..445
APG6 259..440 CDD:367821
Required for membrane-association. /evidence=ECO:0000250|UniProtKB:Q14457 420..445
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.