DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Burs and vwf

DIOPT Version :9

Sequence 1:	NP_650983.1	Gene:	Burs / 42560	FlyBaseID:	FBgn0038901	Length:	173	Species:	Drosophila melanogaster
Sequence 2:	NP_001268918.1	Gene:	vwf / 570643	ZFINID:	ZDB-GENE-070103-1	Length:	2812	Species:	Danio rerio

Alignment Length:	133	Identity:	31/133 - (23%)
Similarity:	53/133 - (39%)	Gaps:	15/133 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly    22 VLVSILKLCTAQPDSSVAATDNDITHLGDDC----------QVTPVIHVLQYPGC-VPKPIPSFA 75
            ||.:::..|......|.......|:.:||.|          :...:::.::...| ..:.|....
Zfish  2683 VLETLVTTCPPFDRKSCLEHGGKISQIGDTCCNMCTEPECRRTVGLLNYIRVDDCQSEEKIELTY 2747

  Fly    76 CVGRCASYIQVSGSKIWQMERSCMCCQESGEREAAVSLFCPKVKPGERKFKKVLTKAPLECMCRP 140
            |.|:|.|....|..| .::|..|:||..:|.....|||.|..   |.:...:||.....:||...
Zfish  2748 CEGKCGSKSVYSLEK-HKVENECVCCSATGTVPMNVSLRCAN---GTQTHHQVLAVTGCDCMSHT 2808

  Fly   141 CTS 143
            |::
Zfish  2809 CSN 2811

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Burs	NP_650983.1	GHB_like	50..138	CDD:419725	23/98 (23%)
vwf	NP_001268918.1	VWD	29..167	CDD:278521
		C8	<227..284	CDD:214843
		TIL	288..341	CDD:280072
		VWC	343..>387	CDD:302663
		VWD	381..534	CDD:278521
		C8	573..641	CDD:285899
		TIL	645..700	CDD:280072
		TIL	760..818	CDD:280072
		VWD	847..1003	CDD:214566
		C8	1043..1112	CDD:285899
		TIL	1131..1181	CDD:280072
		VWA_N2	1183..>1222	CDD:292782
		VWA	1257..1421	CDD:278519
		vWFA_subfamily_ECM	1493..1628	CDD:238727
		VWA	1693..1848	CDD:278519
		VWD	1939..2091	CDD:214566
		C8	2131..2194	CDD:285899
		CT	2731..2808	CDD:214482	22/80 (28%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1216
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900