DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Burs and kcp

DIOPT Version :9

Sequence 1:NP_650983.1 Gene:Burs / 42560 FlyBaseID:FBgn0038901 Length:173 Species:Drosophila melanogaster
Sequence 2:XP_697494.6 Gene:kcp / 569039 ZFINID:ZDB-GENE-070705-443 Length:2200 Species:Danio rerio


Alignment Length:167 Identity:39/167 - (23%)
Similarity:56/167 - (33%) Gaps:48/167 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RHLLRHENNKVFVLILLYCVLVSILKLCTAQPDSSVAAT--DNDITHLGD---DCQVTPVIHVLQ 62
            :|.:.|.::.            |...:|| ||.|:..||  .|::....|   .||...:.....
Zfish  1648 KHNILHSSSD------------SCCPVCT-QPLSNCTATLIGNEVLATDDPCFTCQCKDLTWTCV 1699

  Fly    63 YPGCVP-------KPIPSFACVGRC------ASYIQVSGSKIW-QMERSCMCC------QESGER 107
            :.||.|       :..|..:|...|      .|..:|.....| ..|..|..|      .|...:
Zfish  1700 HRGCPPLSCSPSDQHTPPDSCCPICDVCVLEGSNTRVPDGHRWTDKENECTTCICNKGHIECDLQ 1764

  Fly   108 EAAVSLFCPKVKPGERKFKKVLTKAPLECMCRPCTSI 144
            |.| .|.||.        ..|..|.|.:| |:.||.:
Zfish  1765 ECA-PLQCPD--------GSVKVKNPGKC-CQECTEV 1791

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BursNP_650983.1 GHB_like 50..138 CDD:419725 25/110 (23%)
kcpXP_697494.6 LamG 38..>188 CDD:304605
VWC 365..418 CDD:302663
VWC 424..480 CDD:302663
VWC 540..596 CDD:302663
VWC 599..655 CDD:302663
VWC <681..714 CDD:302663
VWC 778..836 CDD:302663
VWC 891..947 CDD:302663
VWC 1305..1361 CDD:302663
VWC 1422..1478 CDD:302663
VWC 1598..1663 CDD:302663 3/26 (12%)
VWC 1803..1860 CDD:278520
VWD 1867..2016 CDD:278521
C8 2059..2128 CDD:285899
TIL 2139..2192 CDD:280072
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.