DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Burs and BURS_ANOGA

DIOPT Version :9

Sequence 1:NP_650983.1 Gene:Burs / 42560 FlyBaseID:FBgn0038901 Length:173 Species:Drosophila melanogaster
Sequence 2:XP_001688381.1 Gene:BURS_ANOGA / 5667449 VectorBaseID:AGAP002537 Length:98 Species:Anopheles gambiae


Alignment Length:87 Identity:74/87 - (85%)
Similarity:79/87 - (90%) Gaps:0/87 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DNDITHLGDDCQVTPVIHVLQYPGCVPKPIPSFACVGRCASYIQVSGSKIWQMERSCMCCQESGE 106
            |....:..|||||||||||||||||||||||||||:|||||||||||||||||||||||||||||
Mosquito     3 DGGSHYSSDDCQVTPVIHVLQYPGCVPKPIPSFACIGRCASYIQVSGSKIWQMERSCMCCQESGE 67

  Fly   107 REAAVSLFCPKVKPGERKFKKV 128
            |||:|||||||.|.||:||:||
Mosquito    68 REASVSLFCPKAKNGEKKFRKV 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BursNP_650983.1 GHB_like 50..138 CDD:419725 73/79 (92%)
BURS_ANOGAXP_001688381.1 GHB_like 7..97 CDD:304424 73/83 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 184 1.000 Domainoid score I7088
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H122734
Inparanoid 1 1.050 225 1.000 Inparanoid score I5907
OMA 1 1.010 - - QHG28137
OrthoDB 1 1.010 - - D1517793at2759
OrthoFinder 1 1.000 - - FOG0020057
OrthoInspector 1 1.000 - - oto106723
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X15672
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.