DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Burs and tecta

DIOPT Version :9

Sequence 1:	NP_650983.1	Gene:	Burs / 42560	FlyBaseID:	FBgn0038901	Length:	173	Species:	Drosophila melanogaster
Sequence 2:	XP_009300199.1	Gene:	tecta / 561355	ZFINID:	ZDB-GENE-110411-120	Length:	2201	Species:	Danio rerio

Alignment Length:	130	Identity:	22/130 - (16%)
Similarity:	39/130 - (30%)	Gaps:	37/130 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly    34 PDSSVAATDNDITHLGDDCQVTPVIHVLQYPGCVPKPIPSFACVGRCASYIQVSGSKIWQMERSC 98
            ||.|:|   ..:..||...:....               .|.|...||              ::|
Zfish   477 PDGSLA---ESVVELGGSWRAEDT---------------DFRCTDGCA--------------QNC 509

  Fly    99 MCCQESGEREAAVSLFCPKVKPGERKFKKVL-----TKAPLECMCRPCTSIEESGIIPQEIAGYS 158
            ..|:.:.|.....|.:|..:...:..|:...     |.....|:...|::.:....:.|.|..|:
Zfish   510 SMCEPAAEAFYFRSDYCGLINKTDGPFRDCRAVVDPTAFVYSCVYDMCSNRDNITTLCQAIQAYA 574

Fly 159 158
Zfish 575 574

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Burs	NP_650983.1	GHB_like	50..138	CDD:419725	12/92 (13%)
tecta	XP_009300199.1	NIDO	100..256	CDD:214712
		VWD	324..480	CDD:278521	2/2 (100%)
		C8	519..594	CDD:214843	9/56 (16%)
		TIL	597..650	CDD:280072
		VWD	717..875	CDD:214566
		C8	913..989	CDD:214843
		TIL	992..1046	CDD:280072
		VWD	1102..1265	CDD:295339
		C8	1349..1420	CDD:285899
		TIL	1424..1477	CDD:280072
		VWC	1479..1532	CDD:302663
		VWD	1539..1690	CDD:278521
		C8	1732..1803	CDD:214843
		ZP	1850..2102	CDD:214579
		Zona_pellucida	1982..2102	CDD:278526
		FXa_inhibition	2132..2166	CDD:291342
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1216
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900