DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Burs and CRIM1

DIOPT Version :9

Sequence 1:NP_650983.1 Gene:Burs / 42560 FlyBaseID:FBgn0038901 Length:173 Species:Drosophila melanogaster
Sequence 2:XP_011531200.1 Gene:CRIM1 / 51232 HGNCID:2359 Length:1077 Species:Homo sapiens


Alignment Length:166 Identity:34/166 - (20%)
Similarity:55/166 - (33%) Gaps:54/166 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YCVLVSILKLCTAQPDSSVAATDNDITHLGDDCQV--TPVIHVLQYPGCVPKPIPSFACVGR-CA 81
            :||.....:.||           |.:...|:.|.|  .|.|..:..|.|  ..:.:....|: | 
Human   473 HCVATVCGQTCT-----------NPVKVPGECCPVCEEPTIITVDPPAC--GELSNCTLTGKDC- 523

  Fly    82 SYIQVSGSKIWQMERSCMCCQ------ESGEREAAVSLFCP-------------KVKPGERKFKK 127
                ::|.|  :....|..||      ...||:...:|.||             :.:|..:|.:.
Human   524 ----INGFK--RDHNGCRTCQCINTEELCSERKQGCTLNCPFGFLTDAQNCEICECRPRPKKCRP 582

  Fly   128 VLTK--APLE----------CMCRPCTSIEESGIIP 151
            ::..  .||.          |.|:.|..:..|.|.|
Human   583 IICDKYCPLGLLKNKHGCDICRCKKCPELSCSKICP 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BursNP_650983.1 GHB_like 50..138 CDD:419725 23/121 (19%)
CRIM1XP_011531200.1 IGFBP 39..90 CDD:278641
VWC 377..431 CDD:214564
VWC 444..497 CDD:214564 7/34 (21%)
Antistasin 608..633 CDD:280912 4/11 (36%)
VWC 653..703 CDD:302663
VWC 724..775 CDD:302663
VWC 799..849 CDD:214564
VWC 860..914 CDD:302663
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.