DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Burs and Crim1

DIOPT Version :9

Sequence 1:	NP_650983.1	Gene:	Burs / 42560	FlyBaseID:	FBgn0038901	Length:	173	Species:	Drosophila melanogaster
Sequence 2:	NP_056615.1	Gene:	Crim1 / 50766	MGIID:	1354756	Length:	1037	Species:	Mus musculus

Alignment Length:	116	Identity:	21/116 - (18%)
Similarity:	39/116 - (33%)	Gaps:	38/116 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly    42 DNDITHLGDDCQVTPVIHVLQYPGCVPKPIPSFACVGRCASYIQVSGSKIWQMERSCMCCQESGE 106
            ||:..|.|:|..:..::.|:         :|...|:....:::.::..|.|
Mouse   926 DNNRLHPGEDSSLDSIVSVV---------VPIIICLSIIIAFLLINQKKQW-------------- 967

  Fly   107 REAAVSLFC---PKVKPGERKFKKVLTKAPLECMCRPCTSIEESGIIPQEI 154
                |.|.|   ...||..      |....:...|:..|.::..|  ||.:
Mouse   968 ----VPLLCWYRTPTKPSS------LNNQLVSVDCKKGTRVQVDG--PQRM 1006

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Burs	NP_650983.1	GHB_like	50..138	CDD:419725	12/90 (13%)
Crim1	NP_056615.1	IB	37..>95	CDD:197525
		Cell attachment site. /evidence=ECO:0000255	314..316
		VWC	336..390	CDD:214564
		VWC	403..456	CDD:214564
		Antistasin	539..564	CDD:280912
		Antistasin	567..592	CDD:280912
		VWC	683..734	CDD:302663
		VWC	758..808	CDD:302663
		VWC	819..873	CDD:302663
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1216
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900