Protein Alignment Burs and ndrg1

DIOPT Version :9

• Sequence 1: NP_650983.1
• Gene: Burs / 42560
• FlyBaseID: FBgn0038901
• Length: 173
• Species: Drosophila melanogaster
• Sequence 2: NP_001008146.1
• Gene: ndrg1 / 493508
• XenbaseID: XB-GENE-993273
• Length: 395
• Species: Xenopus tropicalis
• Alignment Length: 53
• Identity: 11/53 - (20%)
• Similarity: 21/53 - (39%)
• Gaps: 14/53 - (26%)

  Fly    12 KVFVLILLYCVLVSILKLCTAQPDSSVAATDND--------------ITHLGD 50
            |.||..:.|....|:.:|..::..|:.:::..|              .:|.||
 Frog   306 KYFVQGMGYMPAASMTRLMRSRTGSAASSSSQDGNRSRSHTNEGSRSRSHTGD 358

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
Burs	NP_650983.1	GHB_like	50..138	CDD:419725	1/1 (100%)
ndrg1	NP_001008146.1	Ndr	34..316	CDD:251726	4/9 (44%)
		MhpC	88..311	CDD:223669	3/4 (75%)
		Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite	325..395		5/34 (15%)
		4 X 10 AA tandem repeats of G-[NS]-R-S-R-[AS]-H-T-[DGN]-[DES]. /evidence=ECO:0000255	339..378		3/20 (15%)

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1216
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900