powered by:
Protein Alignment Burs and ndrg1
DIOPT Version :9
Sequence 1: | NP_650983.1 |
Gene: | Burs / 42560 |
FlyBaseID: | FBgn0038901 |
Length: | 173 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001008146.1 |
Gene: | ndrg1 / 493508 |
XenbaseID: | XB-GENE-993273 |
Length: | 395 |
Species: | Xenopus tropicalis |
Alignment Length: | 53 |
Identity: | 11/53 - (20%) |
Similarity: | 21/53 - (39%) |
Gaps: | 14/53 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 KVFVLILLYCVLVSILKLCTAQPDSSVAATDND--------------ITHLGD 50
|.||..:.|....|:.:|..::..|:.:::..| .:|.||
Frog 306 KYFVQGMGYMPAASMTRLMRSRTGSAASSSSQDGNRSRSHTNEGSRSRSHTGD 358
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1216 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.