DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Burs and MUC6

DIOPT Version :9

Sequence 1:	NP_650983.1	Gene:	Burs / 42560	FlyBaseID:	FBgn0038901	Length:	173	Species:	Drosophila melanogaster
Sequence 2:	NP_005952.2	Gene:	MUC6 / 4588	HGNCID:	7517	Length:	2439	Species:	Homo sapiens

Alignment Length:	141	Identity:	32/141 - (22%)
Similarity:	50/141 - (35%)	Gaps:	36/141 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly    26 ILKLCTAQPDSSVAATDNDIT----------------HLGDD-------CQVTPVIHVLQYPGCV 67
            :..|.|..|..:::.|...:|                .||..       |.|......:.:.||:
Human  2300 VTNLTTRHPGPTLSPTTRFLTSSLTAHGSTPASAPVSSLGTPTPTSPGVCSVREQQEEITFKGCM 2364

  Fly    68 PKPIPSFACVGRC---ASYIQVSGSKIWQMERSCMCCQESGEREAAVSLFCPKVK-PGERKFKKV 128
            .. :....|.|.|   ||:..::    .|::..|.||:.....|..:.|.||... ||.|   .|
Human  2365 AN-VTVTRCEGACISAASFNIIT----QQVDARCSCCRPLHSYEQQLELPCPDPSTPGRR---LV 2421

  Fly   129 LT-KAPLECMC 138
            || :....|:|
Human  2422 LTLQVFSHCVC 2432

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Burs	NP_650983.1	GHB_like	50..138	CDD:419725	24/99 (24%)
MUC6	NP_005952.2	VWD	40..192	CDD:214566
		C8	228..297	CDD:285899
		TIL	302..357	CDD:280072
		VWC_out	359..>403	CDD:214565
		VWD	386..549	CDD:214566
		C8	588..660	CDD:285899
		TIL	664..721	CDD:280072
		TIL	782..827	CDD:280072
		VWC	829..886	CDD:302663
		VWD	868..1017	CDD:278521
		C8	1057..1127	CDD:285899
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1202..1455
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1471..1626
		1, truncated	1561..1738
		Approximate repeats	1607..1953
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1642..1834
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1868..1983
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2033..2077
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2090..2196
		PHA03255	2188..>2343	CDD:165513	7/42 (17%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2233..2278
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2323..2348		2/24 (8%)
		CT	2351..2434	CDD:214482	24/90 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1216
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900