DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Burs and Cpn

DIOPT Version :9

Sequence 1:NP_650983.1 Gene:Burs / 42560 FlyBaseID:FBgn0038901 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_731674.1 Gene:Cpn / 41474 FlyBaseID:FBgn0261714 Length:864 Species:Drosophila melanogaster


Alignment Length:45 Identity:13/45 - (28%)
Similarity:21/45 - (46%) Gaps:9/45 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LCTAQPDSSVAATDNDITHLGDDCQVTPVIHVLQYPGCVPKPIPS 73
            :.|....:::|.||.|:|..... ::.|||        .|.|:||
  Fly   367 VATTPVPATLAVTDPDVTASAVP-ELPPVI--------APSPVPS 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BursNP_650983.1 GHB_like 50..138 CDD:419725 7/24 (29%)
CpnNP_731674.1 rne <9..167 CDD:236766
rne <109..300 CDD:236766
rne <228..409 CDD:236766 13/45 (29%)
rne <331..594 CDD:236766 13/45 (29%)
rne <501..763 CDD:236766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.