powered by:
Protein Alignment Burs and Cpn
DIOPT Version :9
Sequence 1: | NP_650983.1 |
Gene: | Burs / 42560 |
FlyBaseID: | FBgn0038901 |
Length: | 173 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_731674.1 |
Gene: | Cpn / 41474 |
FlyBaseID: | FBgn0261714 |
Length: | 864 |
Species: | Drosophila melanogaster |
Alignment Length: | 45 |
Identity: | 13/45 - (28%) |
Similarity: | 21/45 - (46%) |
Gaps: | 9/45 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 LCTAQPDSSVAATDNDITHLGDDCQVTPVIHVLQYPGCVPKPIPS 73
:.|....:::|.||.|:|..... ::.||| .|.|:||
Fly 367 VATTPVPATLAVTDPDVTASAVP-ELPPVI--------APSPVPS 402
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1216 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.