DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Burs and nbl1

DIOPT Version :9

Sequence 1:NP_650983.1 Gene:Burs / 42560 FlyBaseID:FBgn0038901 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_996980.1 Gene:nbl1 / 404629 ZFINID:ZDB-GENE-040426-2357 Length:183 Species:Danio rerio


Alignment Length:157 Identity:43/157 - (27%)
Similarity:66/157 - (42%) Gaps:27/157 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VLILLYCVLVSILKLCTAQPDSSVAATDNDITHLGDD---CQVTPVIHVLQYPGCVPKPIPSFAC 76
            |..:|.|||   |:|..|.|.:.:    |.:....|.   |:...:..::.:.||.|:.|.:.||
Zfish     5 VRAVLVCVL---LELSRAAPHAHI----NRLALFPDKSAWCEAKNITQIVGHTGCTPRSIQNRAC 62

  Fly    77 VGRCASY-----IQVSGSKIWQMERSCMCCQESGEREAAVSLFCPKVKPGERKFKKVLTKAPLEC 136
            :|:|.||     ...|...:...: |||..|...|   .|:|.|.......|..|  |.:..|.|
Zfish    63 LGQCFSYSVPNTFPQSTESLVHCD-SCMPAQTQWE---VVTLDCSGSDEAPRVDK--LVERILHC 121

  Fly   137 MCRPCT--SIEESGIIPQEIAGYSDEG 161
            .|:.|:  |.:|..::..    |..||
Zfish   122 SCQSCSKESSQEGALLQL----YPHEG 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BursNP_650983.1 GHB_like 50..138 CDD:419725 26/95 (27%)
nbl1NP_996980.1 DAN 26..124 CDD:281095 27/103 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..170 43/157 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1517793at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.