DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Burs and crim1

DIOPT Version :9

Sequence 1:NP_650983.1 Gene:Burs / 42560 FlyBaseID:FBgn0038901 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_997986.1 Gene:crim1 / 404210 ZFINID:ZDB-GENE-040312-2 Length:1027 Species:Danio rerio


Alignment Length:146 Identity:38/146 - (26%)
Similarity:50/146 - (34%) Gaps:45/146 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KLCTAQPDSSVAATDN-DITHL-------GDDCQV--TPVIHVLQYPGCVPKPIPSFACVGRCAS 82
            :.|..|...||..|.. .:.|.       |:.|.|  .|:..||...||                
Zfish   349 RFCRCQGGVSVCFTAQCGVLHCERYYVPDGECCPVCEDPIYPVLSLAGC---------------- 397

  Fly    83 YIQVSGSKI-----WQMERSCMCCQ-ESGERE---AAVSLFC--PKVKPGE----RKFKKVLTKA 132
              .|:|..:     |: |..|..|| .||:..   ||....|  |...|||    .:....:|.|
Zfish   398 --YVNGQILAHGDHWR-EDDCTFCQCVSGDARCVAAACGHSCLNPVTVPGECCPVCEEPTYITMA 459

  Fly   133 PLEC-MCRPCTSIEES 147
            |..| ....||.:|:|
Zfish   460 PPACGSLDNCTLLEQS 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BursNP_650983.1 GHB_like 50..138 CDD:419725 27/105 (26%)
crim1NP_997986.1 IGFBP 33..84 CDD:278641
Cell attachment site. /evidence=ECO:0000255 308..310
VWC 330..384 CDD:214564 8/34 (24%)
VWC 397..450 CDD:302663 17/71 (24%)
Antistasin 561..586 CDD:280912
VWC 607..657 CDD:302663
VWC 678..729 CDD:302663
VWC 751..803 CDD:302663
VWC 812..866 CDD:302663
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 877..897
Cell attachment site. /evidence=ECO:0000255 883..885
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.